SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003010 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003010
Domain Number 1 Region: 82-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.31e-22
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 2 Region: 25-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003010   Gene: ENSPTRG00000001804   Transcript: ENSPTRT00000003272
Sequence length 146
Comment pep:novel chromosome:CHIMP2.1.4:1:175526799:175647439:1 gene:ENSPTRG00000001804 transcript:ENSPTRT00000003272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLMVSVILISRISSVGGEVSAEKCGPPPPIDNGDITSFPLSVYAPGSSVEYQCQNLYQL
EGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSG
YHPTKSHSFQAMCQNGKLVHPSCEEK
Download sequence
Identical sequences ENSPTRP00000003010 ENSPTRP00000003010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]