SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003012 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003012
Domain Number 1 Region: 530-592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.62e-19
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number 2 Region: 473-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000473
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 3 Region: 229-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000747
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 4 Region: 290-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000031
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 411-466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000115
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 170-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000127
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 109-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000485
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 47-114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000445
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003012
Domain Number - Region: 353-405
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00031
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003012   Gene: ENSPTRG00000001805   Transcript: ENSPTRT00000003274
Sequence length 593
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:175667259:175699392:1 gene:ENSPTRG00000001805 transcript:ENSPTRT00000003274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKADLKQHHHHWSIFSYIRLRLPSMLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDE
EDYNPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGH
SESSGLIHLEGDTVQIICNTGYSLQNNEKNISCVERGWSTPPICSFTKEECHVPILEANV
DAQPKKESYKVGDVLKFSCRKNLIRVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSN
GEVKEIRKDEYGHNEVVEYDCNPNFIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELE
YGYVQPSVPPYQHGVSVEVNCRNEYAMIGNNMITCINGIWTELPMCVATHQLKKCKIAGV
NIKTLLKLSGKEFNHKSRIRYRCSDIFRYRHSVCINGKWNPELHCTEKREQFCPPPPQIP
NAQNMTTTVNYQDGEKVAVLCKENYLLPETKEIVCKDGQWQSLPRCVESTAYCGPPPSIS
NGDTTSFPLSVYPPGSTVTYRCQSFYKLQGSVTVTCSNKQWSEPPRCLDPCVVSEENMNK
NNIQLKWRNDGKLYAKTGDAVEFQCKFPHKAMISSPPFRAICQEGKFEYPICE
Download sequence
Identical sequences 9598.ENSPTRP00000003012 ENSPTRP00000003012 ENSPTRP00000003012 XP_514078.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]