SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003041 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003041
Domain Number 1 Region: 359-733
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-117
Family Motor proteins 0.0000000428
Further Details:      
 
Domain Number 2 Region: 797-901
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.67e-26
Family FHA domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003041
Domain Number - Region: 1350-1387,1506-1593
Classification Level Classification E-value
Superfamily ARM repeat 0.0194
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003041   Gene: ENSPTRG00000001820   Transcript: ENSPTRT00000003304
Sequence length 1648
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:179298886:179362964:-1 gene:ENSPTRG00000001820 transcript:ENSPTRT00000003304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKV
RDINRTYVISASKKTADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLT
LQRRAKTDSAEKWKTAEIDSVKMTLNVGGETENNGVSKESRTNVRIVNNAKNSFVASSVP
LDEDPQVIEMMADKKYKETFSAPNRANQNVALKYSSNRPPIASLSQTEVVRSGHLTTKPT
QSKLDIKVLGTGNLYHRSIGKEIAKTSNKFGSLEKRTPTKCTTEHKLTPKCSLPQLKSPA
PSILKNRMSNLQVKQRPKSSLLANKQERSAENTILPEEQTVVQNTSAGKDPLKVENSQVT
VAVRVRPFTKREKIEKASQVVFMSGKEITVEHPDMKQVYNFIYDVSFWSFDECHPHYASQ
TTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGKSYTMMGFSEEPGIIPRFCEDLFSQVAR
KQTQEVSYHIEMSFFEVYNEKIHDLLVCKDENGQRKQPLRVREHPVYGPYVEALSMNIVS
SYADIQSWLELGNKQRATAATGMNDKSSRSHSVFTLVMTQTKTEFVEGEEHDHRITSRIN
LIDLAGSERCSTAHTNGDRLKEGVSINKSLLTLGKVVSALSEQANQRSVFIPYRESVLTW
LLKESLGGNSKTAMIATISPAASNIEETLSTLRYANQARLIVNIAKVNEDMNAKLIRELK
AEIAKLKAAQRNNRNIDPERYRLCRQEITSLRMKLHQQERDMAEMQRVWKEKFEQAEKRK
LQETKELQKAGIMFQMDNHLPNLVNLNEDPQLSEMLLYMIKEGTTTVGKYKPNSSHDIQL
SGVLIADDHCTIKNFGGTVSIIPVGEAKTYVNGKHILEITVLRHGDRVILGGDHYFRFNH
PVEVQKGKRPSGRDTPISEGPKDFEFAKNELLMAQRSQLEAEIKEAQLKAKEEMMQGIQI
AKEMAQQELSSQKAAYESKIKALEAELREESQRKKMQEINNQKANHKIEELEKAKQHLEQ
EIYVNKKRLEMETLATKQALEDHSIRHARILEALETEKQKIAKEVQILQQNRNNRDKTFT
MQTTWSSMKLSMMIQEANAISSKLKTYYVFGRHDISDKSSSDTSIRVRNLKLGISTFWSL
EKFESKLAAMKELYESNGSNRGEDVFCDPEDEWEPDITDAPVSSLSRRRSRSLMKNRRIS
GCLHDIQVHPIKNLHSSHSSGLMDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEE
RTIADSLINSFLKIYNGLFAISKAHEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVL
MKHWLSDLLPCTNIARLEDELRQEVKKLGGYLQLFLQGCCSDTSSMIKEAQKNAIQIVQQ
AVKYVGQLAVQKGSKLHFLENGNNKAAGVQEEFMDAVCDGVGLGMKILLDSGLEKAKELQ
HELFRQCTKNEVTKEMKTNAMGLIRSLENIFAESKIKSFRRQVQEENFEYQDFKRMVNRA
PEFLKLKHCLEKAIEIIISALKGCHSDINLLQTCVESICNLANDFYSDFSVPSTSVGSYE
SRVTHIVHQELESLAKSLLFCFESEESPDLLKPWETYNQNTKEEHQQSKSSGIDGSKNKG
VPKRVYELHGSSPAVSSEECTPSRIQWV
Download sequence
Identical sequences 9598.ENSPTRP00000003041 ENSPTRP00000003041 ENSPTRP00000003041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]