SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003120 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003120
Domain Number 1 Region: 121-186
Classification Level Classification E-value
Superfamily F-box domain 0.00000154
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003120   Gene: ENSPTRG00000001864   Transcript: ENSPTRT00000003387
Sequence length 376
Comment pep:known chromosome:CHIMP2.1.4:1:181807112:181823773:1 gene:ENSPTRG00000001864 transcript:ENSPTRT00000003387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVA
NAVQQEVKSLCGLEASQVPAEEALSGAGEPCDIIDSSDEMDAQEESIHERTVSRKKKSKR
HKEELDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL
DASLPLRLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF
WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQYEDVHTNPDQDCCLLQVTTL
NFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSV
RLFDWWHPQYPFSLRA
Download sequence
Identical sequences A0A0D9RP37 A0A2K5J538 A0A2K5L6T2 A0A2K5TQG6 A0A2K6AH90 A0A2K6KMZ2 G1S907 G3R2Z3 H2Q0X7 H9ZFD8 Q8IXX5
ENSNLEP00000021996 ENSPTRP00000003120 ENSP00000356211 ENSPTRP00000003120 ENSNLEP00000021996 NP_001253210.1.72884 NP_612400.3.87134 NP_612400.3.92137 XP_003264620.1.23891 XP_005540529.1.63531 XP_007987095.1.81039 XP_009438437.1.37143 XP_011787175.1.43180 XP_011845891.1.47321 XP_011893243.1.92194 XP_017752057.1.44346 XP_018884495.1.27298 9598.ENSPTRP00000003120 9606.ENSP00000356211 ENSP00000356211 ENSP00000356211 gi|115529437|ref|NP_612400.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]