SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Pan troglodytes 76_2.1.4 > ENSPTRP00000003238

Domain assignment for ENSPTRP00000003238 from Pan troglodytes 76_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSPTRP00000003238
Domain Number 1 Region: 525-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-19
Family Complement control module/SCR domain 0.00025
Further Details:      
 
Domain Number 2 Region: 274-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.0005
Further Details:      
 
Domain Number 3 Region: 776-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 4 Region: 910-974
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-16
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 5 Region: 409-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.37e-16
Family Complement control module/SCR domain 0.0009
Further Details:      
 
Domain Number 6 Region: 349-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.73e-16
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 7 Region: 661-723
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00055
Further Details:      
 
Domain Number 8 Region: 153-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 9 Region: 600-670
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000113
Family Complement control module/SCR domain 0.00071
Further Details:      
 
Domain Number 10 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0000158
Further Details:      
 
Domain Number 11 Region: 964-1028
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000542
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 12 Region: 88-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000931
Family Complement control module/SCR domain 0.0000144
Further Details:      
 
Domain Number 13 Region: 845-904
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 14 Region: 214-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000124
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 740-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000032
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 16 Region: 491-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000135
Family Complement control module/SCR domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003238   Gene: ENSPTRG00000041818   Transcript: ENSPTRT00000003519
Sequence length 1092
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:186554130:186590190:1 gene:ENSPTRG00000041818 transcript:ENSPTRT00000003519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGE
KSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGR
MVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLT
KPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTG
SSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIHCTSNDQERGTWSGPAPLCKLSLLAV
QCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKG
CQPPPGLHHGRHTGGNMVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCEET
CQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCHP
PPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCLR
SPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGVP
TCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTWS
QPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQW
NPPLAVCRSRSLAPVLCGIAAGLILLTFLIVVTLYMISKHRERNYYTNTSQKEAFHLETR
EVYSVDPYNPAS
Download sequence
Identical sequences A0A2J8QVQ2
ENSPTRP00000003238 ENSPTRP00000003238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.