SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003252 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003252
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-16
Family Complement control module/SCR domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000108
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 4 Region: 35-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000124
Family Complement control module/SCR domain 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003252   Gene: ENSPTRG00000001931   Transcript: ENSPTRT00000003533
Sequence length 399
Comment pep:known chromosome:CHIMP2.1.4:1:186832916:186876390:1 gene:ENSPTRG00000001931 transcript:ENSPTRT00000003533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPGRRECPFPSWRFPGLLLAAMVLLLSSFSDACEEPPTFEAMELIGKPKPYYEIGERV
DYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAIPANGTYEFG
YQMHFICNEGYYLIGEEILYCELKGSVAVWSGKPPICEKVLCTPPPKIKNGKHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWVPPVPKCLKVLPPSSTKPPALSHS
VSTSSTTKSPASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIAVIVIAIVVGVAV
ICVVPYRYLQRRKKKGKADGGAEYATYQTKSTTPAEQRG
Download sequence
Identical sequences H2Q117
9598.ENSPTRP00000003252 ENSPTRP00000003252 ENSPTRP00000003252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]