SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003309 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000003309
Domain Number - Region: 104-159
Classification Level Classification E-value
Superfamily STAT 0.0745
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003309   Gene: ENSPTRG00000001966   Transcript: ENSPTRT00000003592
Sequence length 281
Comment pep:known chromosome:CHIMP2.1.4:1:191864152:191919138:-1 gene:ENSPTRG00000001966 transcript:ENSPTRT00000003592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKL
GDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIV
DLATKRKQYPRKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETV
AKEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIE
TTPTETASRKTSNVVLKRKQTKDCPQRKWYPLRPKKINLDT
Download sequence
Identical sequences A0A2I3TNE8
ENSPTRP00000003309 XP_514183.2.37143 9598.ENSPTRP00000003309 ENSPTRP00000003309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]