SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003388 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003388
Domain Number 1 Region: 58-99
Classification Level Classification E-value
Superfamily F-box domain 0.0000353
Family F-box domain 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003388
Domain Number - Region: 259-299
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0131
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003388   Gene: ENSPTRG00000002021   Transcript: ENSPTRT00000003674
Sequence length 368
Comment pep:known chromosome:CHIMP2.1.4:1:203278985:203326527:1 gene:ENSPTRG00000002021 transcript:ENSPTRT00000003674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPPPAPQHPQPGSQALPAPALAPDQLPQ
NNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQV
KAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRV
LRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPG
PSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQD
QKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRK
SKRLRNRK
Download sequence
Identical sequences A0A024R3Q6 G3RP65 H2Q173 Q9NVF7
9598.ENSPTRP00000003388 9606.ENSP00000355827 ENSPTRP00000003388 NP_055991.1.87134 NP_055991.1.92137 XP_001135277.1.37143 XP_003814946.1.60992 XP_018886460.1.27298 gi|7662158|ref|NP_055991.1| ENSP00000355827 ENSP00000355827 ENSPTRP00000003388 ENSP00000355827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]