SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003519 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003519
Domain Number 1 Region: 287-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-47
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-21
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.05e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003519   Gene: ENSPTRG00000002076   Transcript: ENSPTRT00000003811
Sequence length 476
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:207560497:207569392:-1 gene:ENSPTRG00000002076 transcript:ENSPTRT00000003811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVELARKLQEEATCSICLDYFTDPVMTACGHNFCRACIQLSWEKARGKKGRRKRKGSF
PCPECREMSPQRNLLPNRLLTKVAEMARQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVV
CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
RRERIVLEFEKMNLYLVEEEQRLLQALETEEEETASRLRESVACLDRQGHSLELLLLQLE
ERSTQAPLQMLQVSQAWQRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPDA
TSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGMNITG
DALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIF
LDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG
Download sequence
Identical sequences ENSPTRP00000003519 ENSPTRP00000003519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]