SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003538 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000003538
Domain Number - Region: 361-433,517-595,626-716,990-1016,1046-1093,1239-1406
Classification Level Classification E-value
Superfamily ARM repeat 0.0227
Family Armadillo repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003538   Gene: ENSPTRG00000002092   Transcript: ENSPTRT00000003830
Sequence length 1524
Comment pep:known chromosome:CHIMP2.1.4:1:208731658:208765405:1 gene:ENSPTRG00000002092 transcript:ENSPTRT00000003830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVYSGISLKLKSKTTSWEDKLKLAHFAWISHQCFLPNKEQVLLDWARQSLVAFYKKKL
ELKEDIVERLWIYIDNILHSRKLQNLLKNGKTVNLQISLVKIINERVAEFSLSGSQRNIC
AVLRCCQGILSTPALAVIYTAKQELMVALLSQLCWSACRQPEGAVVAQLFEVIHLALGHY
LLILQQQVNPRRAFGDVTAHLLQPCLVLRHLLSGGTWTQAGQGQLRQVLSRDIRSQIEAM
FRGGIFQPELLSSYKEELLDQQQGDVKTGAMKNLLAPMDTVLTRLVDAGYCAASLHTSVV
ANSVALLYKLFLDSYFKEGNQLLCFQVLPRLFGCLKISHLQEEQSKALSTSDWTTELLVV
EQLLNSVANNNIYNIAADRIRHEEAQFRFYRHVAELLINHAQAPIPAWFRCLKTLISLNH
LILEPDLDDLLASAWIDAEVTEFRTKKAQEALIHTVFQTYAKLRQVPRLFEEVLGVICRP
AAEALRQPVLASGPSTVLSACLLELPPSQILDTWSLVLEKFQSLVLPYLQSDADMALKSL
SLSSLLHCIMFNMRSLDSSTPLPIVRRTQCMMERMLRELVQPLLALLLDTPGPEPELWLQ
KVSDSVLLLSYTWAQVDAMFSLNCSQYHSMSGPLIGVALEISNLPSLLPGVKTQHWKKIE
KFTAQFSSLGTYCLEQLYLQKMKRTLMQTSFRSEGAIQSLRCDAAFIIGSGRKSLNQRTT
ASWDGQVGMVSGLTYPVAHWHLIVSNLTILISYLCPDDVGYLASVLLRTLPMGKAQEGSI
DEEAYITLEKISKAFLHSPLFPEMQSLYSAFLTCVTTSCSGILCSGAQRDSGLVSQQLPW
LLEKDHMVVGHWENRFAKAGPEGIEPRGEIPQNLLSLVKSDFPIQLEGEQLESILGLLEV
ISALQLDSLLPPYHVHYFLLLLSMAVTKLGCSCSSSLALKFLTTCYQLLGYLERGKSARS
VFKIMYGSDIFEIVLTSLFRASSRFLIEMDDPAWLEFLQVIGTFLEELMQMLIQMKLSLV
LNFRKITAFLSSSKPYTEAASSKQLENQNPQGRQLLLVSLTRLCHVLGPFLKEQKLGQEA
LAALSELLQQVVLQTGAVLQLCSVPGAQGWRLPSVLISSVSTLLEADLGQHCRDGGADIS
QGSDRTLLSHAALYQGVYSQILLELPALAGHDQSFQAALQFLTLFFLAPELHPKKDSVFT
SMFHSVRRVLADPEIPVQVTQDIEPHLGALFTQMLEVGTTEDLRLVMQCILQGLDVSNMW
KADVQAVVSAVTLLRLLLNCPLSGEKASLLWRACPQIVTALTLLNREACQEQPVSLTVVG
PVLDVLAALLRQGEEAIGNPHHVSLAFSILLTVPLDHLKPLEYGSVFPRLHNVLFSILQC
HPKVMLKAIPSFLNSFNRLVFSVMREGRQKDKGSIDDLPTVLKCARLVERMYSHIAARAE
EFAVFSPFMVAQYVLEVQKVTLYPAVKSLLQEGIYLILDLCIEPDVQFLRASLQPGMRDI
FKELYNDYLKYHKAKHEGEKRYTA
Download sequence
Identical sequences H2Q1B3
ENSPTRP00000003538 ENSPTRP00000003538 9598.ENSPTRP00000003538 XP_001146910.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]