SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003612 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003612
Domain Number 1 Region: 12-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-45
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 
Domain Number 2 Region: 223-357
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.33e-41
Family Galectin (animal S-lectin) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003612   Gene: ENSPTRG00000002140   Transcript: ENSPTRT00000003911
Sequence length 359
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:215834333:215863947:1 gene:ENSPTRG00000002140 transcript:ENSPTRT00000003911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSLNNLQNIIYNPVIPYVGTIPDQLDPGSLIVIRGHVPSDADRFQVDLQNGSSVKPRA
DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG
KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSVLQSTQASSVELTEISRENVPKSGT
PQLPSNREGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNCVSKSLPFAARLNTPMGPG
RTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITS
FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Download sequence
Identical sequences H2Q1E2
9598.ENSPTRP00000003612 ENSPTRP00000003612 XP_001158258.2.37143 XP_009439986.1.37143 XP_009439987.1.37143 XP_009439988.1.37143 XP_016796950.1.37143 ENSPTRP00000003612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]