SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003693 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003693
Domain Number 1 Region: 176-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-26
Family SPRY domain 0.016
Further Details:      
 
Domain Number 2 Region: 386-556
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000011
Family Nucleotide and nucleoside kinases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003693   Gene: ENSPTRG00000002182   Transcript: ENSPTRT00000004000
Sequence length 717
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:224270303:224280681:-1 gene:ENSPTRG00000002182 transcript:ENSPTRT00000004000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERERGAGAADSGPMEEEEAASEDENGDDQGQEGEDELGDEEEGAGDENGHGEQQPQPPAT
QQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAP
AAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVV
CLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRH
LYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITC
FANFESDEVELSYAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFP
IPEEYTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNIL
GTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAA
QRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAEC
FDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRG
RGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNR
GNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Download sequence
Identical sequences ENSPTRP00000003693 ENSPTRP00000003693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]