SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003738 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003738
Domain Number 1 Region: 285-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-61
Family SPRY domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 10-84
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000412
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003738   Gene: ENSPTRG00000002209   Transcript: ENSPTRT00000004050
Sequence length 480
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:227349691:227370470:1 gene:ENSPTRG00000002209 transcript:ENSPTRT00000004050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDSAQGGVYACPQC
RGPFRPSGFRPNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDQAALCWVCDA
GPEHRTHRTAPLQEAAGSYQVKLQMALELVRKELEDALTQEASVGKRTVIWKEKVEVQRQ
RFRLEFEKHRGFLAQEEQRQLRRLEAEERATLQRLRESKSRLVQQSKALKELADELQERC
QRPALGLLEDVRGVLSRSKAVTRLEAENIPMELKTACCIPGRRELDVKLDPATAHPSLLL
TADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSFSSGRHYWEVLVGEGAEWGLGVCQDT
LPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYN
VTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTVAGSGNWASRDHLDPASDVRDDHL
Download sequence
Identical sequences ENSPTRP00000003738 ENSPTRP00000003738 9598.ENSPTRP00000003738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]