SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003825 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003825
Domain Number 1 Region: 486-618,659-879,919-990
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.09e-53
Family Tandem AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 261-315
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000183
Family F-box domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003825   Gene: ENSPTRG00000002261   Transcript: ENSPTRT00000004144
Sequence length 1085
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:5979406:6022087:1 gene:ENSPTRG00000002261 transcript:ENSPTRT00000004144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYKVTSGCHWTCQVPESCDNGLHCAGPLGHLHRRCQRTSAHLLVFTEHAEMRRFKRKHL
TAIDCQHLARSHLAVTQPFGQRWTNRDANHGLYPKPRTKRGSRGQGSQRCIPEFFLAGKR
PCTNDMAKSNSVGQDSCQDSEGDMIFPAESSCALPQEGSGEAGLGSSGSAPPSRKRSWSS
EEESNQATGTSWWDGVSKKAPRHHLSVPCTRPREARQEAEDSTSRLSAESGETDQDAGDM
GPDPIPDSYYGLLGTLPCQEALSHICSLPSEVLRHVFAFLPVEDLYWNLSLVCHLWREII
SDPLFIPWKKLYHRYLMNEEQAVSKVDGILSNCGIEKESDLCVLNLIRYTATTKCSSSVD
PERVLWSLRDHPLLPEAEACVRQHLPDLYAAAGGVNIWALVAAVVLLSSSVNDIQRLLFC
LRRPSSTVTMPDVTETLYCIAVLLYAMREKGINISNRIHYNIFYCLYLQENSCTQATKVK
EEPSVWPGKKTIQLTHEQQLILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSQSRFLY
VTFNKSIAKQAERVFPSNVICKTFHSMAYGHIGRKYQSKKKLNLFKLTPFMVNSVLAEGK
GGFIRAKLVCKTLENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWD
NMRKLGECTEEAYQMTHDGYLKLWQLSKPLLASFDAIFVDEAQDCTPAIMNIVLSQPCGK
IFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTL
VGGNHQSGIRGDAKGQVALLSRTNANVFDEAVRVTEGEFPSRIHLIGGIKSFGLDRIIDI
WILLQPEEERRKQNLVIKDKFIRRWVHKEGFSGFKRYVTAAEDKELEAKIAVVEKYNIRI
PELVQRIEKCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLPQLPHFRV
ESFSEDEWNLLYVAVTRAKKRLIMTKSLENILTLAGEYFLQAELTSNVLKTGVVRCCVGQ
CNNAIPVDTVLTMKKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVRAMERTV
ENIVL
Download sequence
Identical sequences ENSPTRP00000003825 ENSPTRP00000003825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]