SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003828 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003828
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000053
Family Complement control module/SCR domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003828   Gene: ENSPTRG00000002262   Transcript: ENSPTRT00000004147
Sequence length 267
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:6036953:6062577:-1 gene:ENSPTRG00000002262 transcript:ENSPTRT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVLQRPVPPSTVTTAGMTPQPE
SLSPSGKEPAASSPSSNTTAATTAAIVPGSQLMPSKSPSTGTTEIGSHESSHGTPSQTTA
KTWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTGGTSSRDEDLENCSHHL
Download sequence
Identical sequences H2Q1K8
ENSPTRP00000003828 ENSPTRP00000003828 9598.ENSPTRP00000003828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]