SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003829 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003829
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.000016
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000681
Family Complement control module/SCR domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003829   Gene: ENSPTRG00000002263   Transcript: ENSPTRT00000004148
Sequence length 272
Comment pep:known chromosome:CHIMP2.1.4:10:6096186:6147296:-1 gene:ENSPTRG00000002263 transcript:ENSPTRT00000004148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYLLMWGLLTLIMVPGCQAELCDDDPPEITHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLITTTDFQIQTEMAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Download sequence
Identical sequences H2Q1K9
XP_009456144.1.37143 9598.ENSPTRP00000003829 ENSPTRP00000003829 ENSPTRP00000003829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]