SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003935 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003935
Domain Number 1 Region: 19-222
Classification Level Classification E-value
Superfamily L domain-like 4.88e-43
Family Ngr ectodomain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003935   Gene: ENSPTRG00000002325   Transcript: ENSPTRT00000004266
Sequence length 277
Comment pep:known chromosome:CHIMP2.1.4:10:17045175:17273309:-1 gene:ENSPTRG00000002325 transcript:ENSPTRT00000004266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLKKMVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTTVPPNIA
ELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNN
LSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELT
QLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSE
TYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Download sequence
Identical sequences K7DA77
ENSPTRP00000003935 ENSPTRP00000003935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]