SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004113 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004113
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.45e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000533
Further Details:      
 
Domain Number 2 Region: 428-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000556
Further Details:      
 
Domain Number 3 Region: 645-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-36
Family MAM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00000111
Further Details:      
 
Domain Number 5 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004113   Gene: ENSPTRG00000002414   Transcript: ENSPTRT00000004457
Sequence length 923
Comment pep:known chromosome:CHIMP2.1.4:10:33634346:33792563:-1 gene:ENSPTRG00000002414 transcript:ENSPTRT00000004457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEVHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
VNEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
FELVDGVKLKKDKLNTQSTYSEA
Download sequence
Identical sequences H2Q1T2
9598.ENSPTRP00000004113 ENSPTRP00000004113 ENSPTRP00000004113 XP_001143690.1.37143 XP_003814837.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]