SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004277 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004277
Domain Number 1 Region: 30-199
Classification Level Classification E-value
Superfamily L domain-like 2.04e-31
Family Leucine rich effector protein YopM 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004277   Gene: ENSPTRG00000002483   Transcript: ENSPTRT00000004635
Sequence length 261
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL391668.1:1338094:1342846:-1 gene:ENSPTRG00000002483 transcript:ENSPTRT00000004635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKGEKGPKGKKINLKVAKNCIKITFDGKKRLDLSKMGITTFPKCILRLSDVDELDLSRN
LIRKIPDSISKFQNLRWLDLHSNYIDKLPQSIGQMTSLLYLNVSNNRLTSNGLPVELKQL
KNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSMSKLPKLKKLNIKRNPFP
KPGESEMFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNL
ISPNSMAKDSWEDWRIRLTSS
Download sequence
Identical sequences H2RH16
ENSPTRP00000004277 9598.ENSPTRP00000004277 ENSPTRP00000004277 XP_008959423.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]