SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004279 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004279
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000168
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004279   Gene: ENSPTRG00000002484   Transcript: ENSPTRT00000004637
Sequence length 320
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL391668.1:1444432:1549733:-1 gene:ENSPTRG00000002484 transcript:ENSPTRT00000004637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLALEADALLARAPAPEVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAV
RWFFAHSSDSQEALMVKMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPS
DQGHYICRVQEISRHRNKWTAWSNGSSATEMRVISLKASEESSFEKTKETWAFFEDLYVY
AVLVCCVGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGETVTSVTSLAPLQPK
KGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRA
AKGAPTSTVYAQILFEENKL
Download sequence
Identical sequences ENSPTRP00000004279 9598.ENSPTRP00000004279 ENSPTRP00000004279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]