SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004545 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004545
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000351
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000004545
Domain Number - Region: 144-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000464
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 64-122
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.1
Family Creatinase/aminopeptidase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004545   Gene: ENSPTRG00000002617   Transcript: ENSPTRT00000004927
Sequence length 545
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:71467607:71509879:1 gene:ENSPTRG00000002617 transcript:ENSPTRT00000004927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDKDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDIEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPVVHVSGLESLVESCFATPTSKIDGVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRILVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIR
IDWED
Download sequence
Identical sequences A0A2J8NUJ8
ENSPTRP00000004545 9598.ENSPTRP00000004545 ENSPTRP00000004545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]