SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004580 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004580
Domain Number 1 Region: 243-407,747-842
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.49e-72
Family beta-sandwich domain of Sec23/24 0.002
Further Details:      
 
Domain Number 2 Region: 499-744
Classification Level Classification E-value
Superfamily vWA-like 3.34e-72
Family Trunk domain of Sec23/24 0.0000736
Further Details:      
 
Domain Number 3 Region: 949-1090
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.99e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00065
Further Details:      
 
Domain Number 4 Region: 844-948
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.63e-31
Family Helical domain of Sec23/24 0.0067
Further Details:      
 
Domain Number 5 Region: 410-495
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.44e-25
Family Zn-finger domain of Sec23/24 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004580   Gene: ENSPTRG00000002637   Transcript: ENSPTRT00000004962
Sequence length 1094
Comment pep:known chromosome:CHIMP2.1.4:10:72320447:72349441:1 gene:ENSPTRG00000002637 transcript:ENSPTRT00000004962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPGYQQTPPQGMS
RAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQ
PAVLQPYGPPPTSAQVATQLSGMQISGAVAPAPPSSGLGFGPPTSLASASGSFPNSGLYG
SYPQGQAPPLSQAQGHPGIQTPQRSAPSQASSFTPPASGGPRLPSMTGPLLPGQSFGGPA
VSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGSPY
PAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTN
FLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELS
LGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGA
EESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITS
LLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDD
RKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSV
YKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVEL
AGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR
NCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPEC
MKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVAETNVFFYPRLLPLTKSPVE
STTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSV
LPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKLEMLFKHFLVEDKSLSGGASYVD
FLCHMHKEIRQLLS
Download sequence
Identical sequences H2Q241
ENSPTRP00000004580 9598.ENSPTRP00000004580 ENSPTRP00000004580 XP_001145058.1.37143 XP_001145134.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]