SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004890 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004890
Domain Number 1 Region: 154-348
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.94e-59
Family Astacin 0.0000888
Further Details:      
 
Domain Number 2 Region: 578-688
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 739-845
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 355-464
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 5 Region: 869-962
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-29
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 6 Region: 464-531
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000327
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 7 Region: 689-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000028
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 533-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004890   Gene: ENSPTRG00000002795   Transcript: ENSPTRT00000005286
Sequence length 973
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:95834345:95982636:-1 gene:ENSPTRG00000002795 transcript:ENSPTRT00000005286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAG
KDGWENTTLLHSPGTLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIF
KQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIV
AHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMH
YARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTG
NFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAP
LLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQSPNY
PDDYRPSKECVWRIMVSEGFHVGLTFQAFERLWMKFVSDGSINKAGFAANFFKEVDECSW
PDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPT
NKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETPEV
ITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGY
RLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFE
IEQHQECAYDHLEMYDGPDSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQ
AVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSQAHCDWVIVAEDGYGVELTFRTFEVEE
EADCGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHAQY
TSTKFQDALHMKK
Download sequence
Identical sequences ENSPTRP00000004890 ENSPTRP00000004890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]