SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005097 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000005097
Domain Number - Region: 149-188
Classification Level Classification E-value
Superfamily UBA-like 0.00187
Family CUE domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005097   Gene: ENSPTRG00000002891   Transcript: ENSPTRT00000005511
Sequence length 287
Comment pep:known chromosome:CHIMP2.1.4:10:101636897:101645510:-1 gene:ENSPTRG00000002891 transcript:ENSPTRT00000005511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEML
KEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQ
MLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEA
PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Download sequence
Identical sequences A0A2I3GD53 A0A2K6MZA4 A0A2K6RMA6 G3QVR5 K7CM68 Q9H467
ENSP00000358953 ENSNLEP00000018397 ENSPTRP00000005097 NP_076945.2.87134 NP_076945.2.92137 XP_003255446.1.23891 XP_004050068.1.27298 XP_010354472.1.97406 XP_017707196.1.44346 XP_018890198.1.27298 ENSNLEP00000018397 ENSP00000358953 ENSP00000358953 gi|148596996|ref|NP_076945.2| ENSPTRP00000005097 9598.ENSPTRP00000005097 9606.ENSP00000358953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]