SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005122 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005122
Domain Number 1 Region: 133-183
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000895
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 265-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000331
Family APG12-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005122   Gene: ENSPTRG00000002908   Transcript: ENSPTRT00000005537
Sequence length 350
Comment pep:known chromosome:CHIMP2.1.4:10:102541914:102589926:-1 gene:ENSPTRG00000002908 transcript:ENSPTRT00000005537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVAVVTAGSVGAAKTEGAAALPPPPPVSPPALIPAPAAGEEGPAPLSETGAPGCSGSR
PPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEE
RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ
PLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKV
LESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDP
ACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
Download sequence
Identical sequences H2Q2I5
XP_508012.2.37143 ENSPTRP00000005122 ENSPTRP00000005122 9598.ENSPTRP00000005122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]