SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005454 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005454
Domain Number 1 Region: 786-894
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 2 Region: 583-668
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 
Domain Number 3 Region: 226-332
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 331-436
Classification Level Classification E-value
Superfamily SRCR-like 1.27e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 437-539
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00043
Further Details:      
 
Domain Number 6 Region: 25-131
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 7 Region: 133-230
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000102
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 
Domain Number 8 Region: 665-712
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000968
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005454   Gene: ENSPTRG00000003097   Transcript: ENSPTRT00000005897
Sequence length 1033
Comment pep:novel chromosome:CHIMP2.1.4:10:133266607:133306618:1 gene:ENSPTRG00000003097 transcript:ENSPTRT00000005897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAALWTLGLGPLLFNLWAVPIGGPGALRLAYRHSTCDRVALVRHHGAWGYVCNQQWMLA
EASVVCRQLGCGPAVGAPKYVPLPGEMAQPWLHNVSCRGNESSLWECSLGSWCQSPCPHA
WVVVALCSNGTFRELWLVKGRSPCAGLPEIRNVNGVDRLCGLHVEEAMVFCRELGCGPVL
QAPRRDVGVIRKYLACRGTEPTIRSCRLDNNFRSGCDLRLVAEVDCSGHTEARLVGGEHP
CAGRLEVRRGLTWGTVCDADLDLATAHVVCRELQCGAVVSTPKGARFGRGSGPVWTEAFR
CVGNESLLFHCPRGRGSQCGHGHDAGLRCSEFRMVNGSSSCEGHVELQVQGSWAPLCATH
WDIADATVLCHQLNCGNAVAAPGGGHFGDGDAAIWPDAFHCEGTEPYLWNCPVSTLGAPA
CAPGNTASAVCSGLPHALRLREGQSRCDGRVEVSLDGVWGRVLDDAWDLHGAGVVCRQLG
CGGAQQAYDAPAPSRGSVQVALSRVRCLGTETHLTQCNVSATLQEPAGTSRDAGVVCSGE
GGTASPMARRHGIPGALTLSLHREPQGAAGRGAGALCGARGGHGGAWGTVCDDAWDLRDA
HVVCRQLGCGRALSALGAAHFGAGAGRIWLDELSCQGHESALWQCPSAGWGRHDCRHKED
AGVFCSESVALRLRGGTCCCAGWLDVFYNGTWGAVCSNALKDLSLSIICKQGVWGVGLAG
EQALPLCGHRDRLGGQHRVLQAAQLHSVAMPFPPMAPALLPLRAGLSEDRPQAAGEPLNC
SSSLGCPEEGALRVRGGEDRCSGRVELWHAGSWGTVCDDGWDLADAEVVCRQLGCGRAVA
ALGAAAFGPGSGPVWLDEVGCRGSEASLWGCPAERWGRGDCAHKEDAGVRCWEPGPGPPL
PAAPFRTFWVVSVVLGALLGLLLLGLMAFLILPRVTQAMQRGLGRSEVSPGEAIYDVIGE
MPLAGLYEEITEAEAVLQDEEDGSVVKVDTEAAVSGEVSNLLEGQSIRAEGGHSRPVSQG
YDEAAFPLEEMTL
Download sequence
Identical sequences ENSPTRP00000005454 ENSPTRP00000005454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]