SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005487 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005487
Domain Number 1 Region: 155-303
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-27
Family Toll/Interleukin receptor TIR domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000005487
Domain Number - Region: 28-104
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000226
Family C1 set domains (antibody constant domain-like) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005487   Gene: ENSPTRG00000003115   Transcript: ENSPTRT00000005939
Sequence length 405
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:433167:437787:-1 gene:ENSPTRG00000003115 transcript:ENSPTRT00000005939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVCDRAPDFLSPFEDQVPRPALGSSVVTCTAWVVFGPHCSLPSVQWMKDGLPLNGGHYSL
HEHSWVKANLSEVLVSSVLGVNVTSAEVYGAFTCSIQNISFSFTLQRAGPTSHVAAVLAS
LLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEMNDGKLYDAYFSYSDCPEDRKFMNFIL
KPHLERRRGYKLFLDDPDLLPRSEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREG
LCRLLELTRRPIFITFESQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFWKEVQL
ALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGVRGPVFGE
PSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
Download sequence
Identical sequences ENSPTRP00000005487 ENSPTRP00000005487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]