SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005680 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005680
Domain Number 1 Region: 295-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-66
Family SPRY domain 0.00000491
Further Details:      
 
Domain Number 2 Region: 5-83
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-22
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 89-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000443
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005680   Gene: ENSPTRG00000003219   Transcript: ENSPTRT00000006155
Sequence length 485
Comment pep:known chromosome:CHIMP2.1.4:11:4373766:4383296:-1 gene:ENSPTRG00000003219 transcript:ENSPTRT00000006155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTALVEAIVEEVACPICMTFLREPMSIDCGHSFCHSCLSGLWEIPGESQNWGYTCPLC
RAPVQPRNLRPNWQLANVVEKVRLLRLHPGMGLKGDLCERHGEKLKMFCKEDVLIMCEAC
SQSPEHEAHSVVPMEDVAWEYKWELHEALEHLKKEQEEAWKLEVGERKRTATWKIQVETR
KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELNHSELIQQSQV
LWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPVSLELKTDCRVLGLREILKT
YAADVRLDPDTAYSRLIVSEDRKRVHYGDTNQKLPDNPERFYRYNIVLGSQCISSGRHYW
EVEVGDRSEWGLGVCKQNVDRKEVVYLSPHYGFWVIRLRKGNEYRAGTDEYPLLSLPVPP
RRVGIFVDYEAHDISFYNVTDYGSHIFTFPRYPFPGRLLPYFSPCYSIGTNNTAPLAICS
LDGEE
Download sequence
Identical sequences H2Q2Y4
ENSPTRP00000005680 ENSPTRP00000005680 XP_521739.2.37143 9598.ENSPTRP00000005680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]