SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005708 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005708
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 3.98e-55
Family Globins 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005708   Gene: ENSPTRG00000022526   Transcript: ENSPTRT00000006185
Sequence length 147
Comment pep:known chromosome:CHIMP2.1.4:11:5020122:5021919:-1 gene:ENSPTRG00000022526 transcript:ENSPTRT00000006185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFG
KEFTPEVQAAWQKLVSAVAIALAHKYH
Download sequence
Identical sequences A0A1K0GUW1 D9YZU7 P02100 Q6LDH0 Q6LDH1
ENSP00000292896 ENSP00000369586 NP_001129304.1.37143 NP_005321.1.87134 NP_005321.1.92137 XP_003819078.1.60992 XP_004050587.1.27298 ENSP00000292896 ENSP00000369586 9598.ENSPTRP00000005708 9606.ENSP00000292896 ENSPTRP00000005708 ENSPTRP00000005708 gi|4885393|ref|NP_005321.1| ENSP00000292896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]