SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005727 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005727
Domain Number 1 Region: 295-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-48
Family SPRY domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-24
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 91-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.43e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005727   Gene: ENSPTRG00000040665   Transcript: ENSPTRT00000006206
Sequence length 488
Comment pep:known chromosome:CHIMP2.1.4:11:5400888:5421381:1 gene:ENSPTRG00000040665 transcript:ENSPTRT00000006206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKILLNVQEEVTCPICLELLTEPLSLDCGHSLCRACITVSNKEAVTSVGGKSSCPVCG
ISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCDHHGEKLLLFCKEDRKVICWLCE
RSQEHRGHHTVLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTER
QRIQTEFDQLRSILNNEEQRELQRLEEEEKKTLDKFAEAEDELVQQKQLVRELISDVECR
SQWSTMELLQDMSGIMKWSEIWRLKKPKTVSKKLKTVFHAPDLSRMLQMFRELTAVRCYW
VDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTA
WILGVYCRTYSRHMKYVVRRCANRQNLYSKYRPLFGYWVIGLQNKCKYGVFEESLSSDPE
VLTLSMAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYQFSKCCFSQPVYPYFNPWNCPAP
MTLCPPSS
Download sequence
Identical sequences H2Q303
ENSPTRP00000005727 NP_001192106.1.37143 ENSPTRP00000005727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]