SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005730 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005730
Domain Number 1 Region: 292-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-43
Family SPRY domain 0.0000572
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-26
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.44e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005730   Gene: ENSPTRG00000003258   Transcript: ENSPTRT00000006209
Sequence length 493
Comment pep:known chromosome:CHIMP2.1.4:11:5440246:5462673:-1 gene:ENSPTRG00000003258 transcript:ENSPTRT00000006209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCAHHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKDEPQYRKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQSVRELISDLERRLQ
GSVMELLQKVSGKILRMENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDMRQVSSPKPQIIYGARGTRYQTFMNFNYCTGILGSQSITSGKHY
WEVDVSKKSAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDGSFHT
PSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGSLIYKFSHCSFSQPVFPYLNPR
KCGVPMTLCSPSS
Download sequence
Identical sequences ENSPTRP00000005730 ENSPTRP00000005730 9598.ENSPTRP00000054834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]