SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005841 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005841
Domain Number 1 Region: 810-918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 2 Region: 321-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 42-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 283-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000106
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 632-658,691-806
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000419
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 173-319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000502
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005841   Gene: ENSPTRG00000003342   Transcript: ENSPTRT00000006333
Sequence length 996
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:8830986:8905251:-1 gene:ENSPTRG00000003342 transcript:ENSPTRT00000006333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVAGRNRPGAAWAVLLLLLPPLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQ
NTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDG
HNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEESLSCMNKDHG
CSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADGPECSCHPQY
KMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDTSTG
VHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGSFDCSCKKGFKLLTDEKSCQ
DVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVNTVG
SYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDRCFLRCHSGIHLSSD
VTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGA
PGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHL
QLSGMNLDVAKKPPRTSERQAESCGVGQGHAENQCVSCRAGTYYDGAQERCILCPNGTFQ
NEEGQITCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEA
GRTSCFPCGGGLATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRCPVGTYQPEFGKNN
CVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPP
KRRILIVVPEIFLPIEDDCGDYLVMRKPASSNSVTTYETCQTYERPIAFTSRSKKLWIQF
KSNEGNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAH
PQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSPTRP00000005841 ENSPTRP00000005841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]