SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006044 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006044
Domain Number 1 Region: 53-106
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-19
Family GLA-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006044   Gene: ENSPTRG00000003480   Transcript: ENSPTRT00000006557
Sequence length 226
Comment pep:known chromosome:CHIMP2.1.4:11:32772027:32797653:1 gene:ENSPTRG00000003480 transcript:ENSPTRT00000006557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELF
TPGNLERECNEELCNYEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTG
LIAAGVFLVIFGLLGYYLCMTKCNGLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPS
VEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
Download sequence
Identical sequences H2Q3D2
ENSPTRP00000006044 XP_009458462.1.37143 ENSPTRP00000006044 9598.ENSPTRP00000006044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]