SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006047 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006047
Domain Number 1 Region: 38-177
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-22
Family DEP domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006047
Domain Number - Region: 255-418,469-507
Classification Level Classification E-value
Superfamily ARM repeat 0.00189
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006047   Gene: ENSPTRG00000003482   Transcript: ENSPTRT00000006560
Sequence length 511
Comment pep:known chromosome:CHIMP2.1.4:11:32975194:32992883:1 gene:ENSPTRG00000003482 transcript:ENSPTRT00000006560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLK
RHNDCFVGSEAVDVIFSHLIQNKYFGDIDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDK
KPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSL
KPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQS
TMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKE
LLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRR
LLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVF
KIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQHDYSNNTEKTTKDELLNLLKTLD
EDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
Download sequence
Identical sequences H2Q3D4
ENSPTRP00000006047 ENSPTRP00000006046 9598.ENSPTRP00000006047 XP_001143476.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]