SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006059 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006059
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.14e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 3.01e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006059
Domain Number - Region: 419-451
Classification Level Classification E-value
Superfamily ARM repeat 0.00455
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006059   Gene: ENSPTRG00000003490   Transcript: ENSPTRT00000006572
Sequence length 471
Comment pep:known chromosome:CHIMP2.1.4:11:33706030:33739597:-1 gene:ENSPTRG00000003490 transcript:ENSPTRT00000006572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences G1S8C1 G3S6Q5 H2NDR2 H2Q3E0 Q9UK99
NP_036307.2.87134 NP_036307.2.92137 XP_003254434.1.23891 XP_003830437.1.60992 XP_004050960.1.27298 XP_009244756.1.23681 XP_508358.2.37143 ENSP00000265651 9598.ENSPTRP00000006059 9600.ENSPPYP00000003870 9606.ENSP00000265651 ENSPPYP00000003870 ENSP00000265651 gi|15812186|ref|NP_036307.2| ENSNLEP00000021760 NYSGRC-15812186 ENSPTRP00000006059 ENSP00000265651 ENSGGOP00000001919 ENSPPYP00000003870 ENSGGOP00000023762 ENSNLEP00000021760 ENSPTRP00000006059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]