SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006127 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006127
Domain Number 1 Region: 150-228
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-28
Family Homeodomain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006127
Domain Number - Region: 47-80
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00136
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006127   Gene: ENSPTRG00000003529   Transcript: ENSPTRT00000006641
Sequence length 366
Comment pep:novel chromosome:CHIMP2.1.4:11:44363146:44410032:-1 gene:ENSPTRG00000003529 transcript:ENSPTRT00000006641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGDKVGTTFLSAKAQGDKTRARYGAGQQDLATPLRSGAARGSFNKFQPQPSTLQHQPPQ
QPQQQQPQLQPPAQPHLYLQRGACKTPPDGSLKLQEGSSGHSAALQVPCYAKESSLGEPE
LPPDSDTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQ
LEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHF
STAYELPLLTRAENYAQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASS
VTDFLSVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSA
AISWAT
Download sequence
Identical sequences ENSPTRP00000006127 ENSPTRP00000006127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]