SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006241 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006241
Domain Number 1 Region: 276-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-48
Family SPRY domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily RING/U-box 2.36e-17
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 87-138
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000565
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006241   Gene: ENSPTRG00000034335   Transcript: ENSPTRT00000006763
Sequence length 446
Comment pep:novel scaffold:CHIMP2.1.4:GL391863.1:15852:21251:-1 gene:ENSPTRG00000034335 transcript:ENSPTRT00000006763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDDLQVFQNELICCICMNYFIDPVTIDCGHSFCRPCLCLCSEEGRAPMRCPSCRKISE
KPNFNTNVVLKKLASLARQTRPQNIKSSDSICVLHEETKELFCEADKRLLCGPCSESPEH
MAHSHSPIGWAAEECRVQKLIKEMDYLWKIDQETRNNLNQETSTFHSLKEDERNRIVYRY
QKMPIFLDEEEQRHLQALEREAEELFQQLQDSQVRMTQHLERMKDMYRELWETCHMADVE
LLQDVRNVSARTDLAQMQKPQPVNPELTSWCITGVLDMLNNFRVDNALSTEMIPCYISLS
EDVRYVIFGDEHLSAPTDPQGVDSFAVWGAQAFTSGKHYWEVDVTLSSNWILGVCRDSRT
ADANFVIDSDERFFISSKTSNHYSLSTNSPPLIQYVQRPLGRVGVFLDYDNGSVSFFDVS
KGSLIYGFPPSSFSSPLRPFFCFGCT
Download sequence
Identical sequences ENSPTRP00000006241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]