SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006415 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006415
Domain Number 1 Region: 155-263
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 261-364
Classification Level Classification E-value
Superfamily SRCR-like 9.55e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 41-158
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006415   Gene: ENSPTRG00000003728   Transcript: ENSPTRT00000006954
Sequence length 668
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:58801465:58851912:1 gene:ENSPTRG00000003728 transcript:ENSPTRT00000006954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFFEITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSAAANAT
LAGAPAVLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWGVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PALPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEEFTLSNCSWRFNNSNLCSQSLAARVLC
SDSRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKPPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
DYDDIGAA
Download sequence
Identical sequences ENSPTRP00000006415 9598.ENSPTRP00000006415 ENSPTRP00000006415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]