SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006428 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006428
Domain Number 1 Region: 125-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 678-744
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000023
Family VWC domain 0.0056
Further Details:      
 
Domain Number 3 Region: 493-561
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000146
Family VWC domain 0.022
Further Details:      
 
Domain Number 4 Region: 628-687
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000167
Family VWC domain 0.0066
Further Details:      
 
Domain Number 5 Region: 384-441
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.026
Further Details:      
 
Domain Number 6 Region: 567-625
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000188
Family VWC domain 0.011
Further Details:      
 
Domain Number 7 Region: 434-495
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000492
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006428   Gene: ENSPTRG00000003736   Transcript: ENSPTRT00000006969
Sequence length 944
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:59082827:59121153:-1 gene:ENSPTRG00000003736 transcript:ENSPTRT00000006969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAGLLLRAACVALLLPGAPARGYTGRKPPGHFAAERRRLGPHVCLSGFGSGCCPGWAPS
MGGGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPETHGPCGEYGCDLTCNHGGCQE
VARVCPVGFSMTETAVGIRCTDIDECVTSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQ
DTDECLGTPCQQRCKNSIGSYKCSCRTGFHLHGNRHSCVDVNECRRPLERRVCHHSCHNT
VGSFLCTCRPGFRLRADRVSCEAFPKAVLAPSAILQPRQHPSKMLLLLPEAGRPALSPGH
SPPSGAPGPPAGVRTTRLPSPTPRLPTSSPSAPVWLLSTLMATPVPTASLLGNLRPPSLL
QGEVMGTPSSPRGPESPRLAAGPSPCWHLGAMHESRSRWTEPGCSQCWCEDGKVTCEKVR
CEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPEC
PSGPCQTPPQSDCCTCVPVRCYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFMPCPE
LACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSV
SCKRTDCVDSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNETFPSVLDPCLSCICLLGSVA
CSPVDCPITCTYPFHPDGECCPVCRDCNYEGRKVANGQVFTLDDEPCTRCTCQLGEVSCE
KVPCQRACADPALIPGDCCSSCPDSLSPLEEKQGLSPHGNVAFSKAGRSLHGDTEAPVNC
SSCPGPSTASPSRPVLHLLQLLLRMNLMKTQTLPTSPAGAHGPHSPALGLTGTFPGEPGA
SPRLSPGPSTPPGAPTLPLASPGAPQPPPVTPERSFSASGARIVSRWPPQTATLLTEASP
WKTITLSGPRMLSPTTSRLTAAATTHPGPQQPPVGASRGEESTM
Download sequence
Identical sequences ENSPTRP00000006428 ENSPTRP00000006428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]