SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006496 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006496
Domain Number 1 Region: 153-284
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-22
Family UBX domain 0.015
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 8.62e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006496   Gene: ENSPTRG00000003780   Transcript: ENSPTRT00000007043
Sequence length 310
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:60597797:60600156:-1 gene:ENSPTRG00000003780 transcript:ENSPTRT00000007043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPVLSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTWGSREACLG
KGGMQREGAL
Download sequence
Identical sequences H2Q3W4
ENSPTRP00000006496 ENSPTRP00000006496 XP_008952147.1.60992 XP_009421555.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]