SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006511 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006511
Domain Number 1 Region: 370-554
Classification Level Classification E-value
Superfamily NTF2-like 2.46e-65
Family NTF2-like 0.000000012
Further Details:      
 
Domain Number 2 Region: 109-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.74e-36
Family Non-canonical RBD domain 0.0000047
Further Details:      
 
Domain Number 3 Region: 204-359
Classification Level Classification E-value
Superfamily L domain-like 7.65e-33
Family mRNA export factor tap 0.000000143
Further Details:      
 
Domain Number 4 Region: 551-619
Classification Level Classification E-value
Superfamily UBA-like 5.87e-26
Family TAP-C domain-like 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006511   Gene: ENSPTRG00000003791   Transcript: ENSPTRT00000007059
Sequence length 619
Comment pep:known chromosome:CHIMP2.1.4:11:60716594:60730111:-1 gene:ENSPTRG00000003791 transcript:ENSPTRT00000007059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
Download sequence
Identical sequences A0A2K5KD70 A0A2K5P000 A0A2K5VTK3 A0A2K5XT97 A0A2K6CE54 A0A2K6MQ52 A0A2K6RLR5 H2Q3X3 H9YW98 Q9UBU9
ENSPTRP00000006511 9598.ENSPTRP00000006511 9606.ENSP00000294172 ENSPTRP00000006511 ENSP00000294172 ENSP00000436679 ENSP00000294172 ENSP00000436679 NP_006353.2.87134 NP_006353.2.92137 XP_003828548.1.60992 XP_005577609.1.63531 XP_010383162.1.97406 XP_011718793.1.29376 XP_011798053.1.43180 XP_011848791.1.47321 XP_011897413.1.92194 XP_014969442.1.72884 XP_016775302.1.37143 XP_017733828.1.44346 ENSP00000294172 gi|15487670|ref|NP_006353.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]