SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006621 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006621
Domain Number 1 Region: 892-1072
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 482-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.4e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 698-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-34
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 24-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.32e-30
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1105-1245,1274-1316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.04e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006621
Domain Number - Region: 210-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000332
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006621   Gene: ENSPTRG00000003843   Transcript: ENSPTRT00000007180
Sequence length 1712
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:62533243:62648786:-1 gene:ENSPTRG00000003843 transcript:ENSPTRT00000007180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTM
LGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQG
DLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRSGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKG
SISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRD
LFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFVCDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADT
LRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVD
NVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSG
NGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDS
RTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYI
FGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTV
GVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKV
LALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRG
RSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRS
PFVPPPPTFYPFLTGVGATQDTLPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEV
FDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNL
PAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGER
GPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNS
AQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV
Download sequence
Identical sequences A0A2I3SJ47
ENSPTRP00000006621 XP_001165542.2.37143 ENSPTRP00000006621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]