SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006938 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006938
Domain Number 1 Region: 44-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.76e-18
Family Splicing factor U2AF subunits 0.00000597
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006938
Domain Number - Region: 16-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000392
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 150-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000581
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006938   Gene: ENSPTRG00000013952   Transcript: ENSPTRT00000007520
Sequence length 240
Comment pep:known chromosome:CHIMP2.1.4:21:29142972:29157508:-1 gene:ENSPTRG00000013952 transcript:ENSPTRT00000007520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ
TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
Download sequence
Identical sequences A0A096NIP6 A0A1U7UGA6 A0A2K5D5Y9 A0A2K5P5H5 A0A2K5SCV4 A0A2K5V1L6 A0A2K6BKL3 A0A2K6KG37 F1PUP0 F7BT41 H2Q4C7
ENSMICP00000012617 9544.ENSMMUP00000003198 ENSCAFP00000015559 ENSPTRP00000006938 ENSPANP00000012844 ENSP00000369629 ENSP00000482964 ENSMMUP00000029977 ENSPTRP00000006938 ENSCAFP00000040371 NP_001020374.1.92137 NP_001307577.1.87134 NP_001307577.1.92137 XP_002803161.1.72884 XP_003319151.1.37143 XP_003419078.1.64505 XP_003640135.1.84170 XP_004406637.1.74151 XP_005548645.1.63531 XP_006870879.1.41390 XP_006894000.1.29581 XP_007945453.1.48129 XP_007967576.1.81039 XP_008069165.1.4292 XP_008143897.1.99482 XP_010381470.1.97406 XP_011724240.1.29376 XP_011892778.1.92194 XP_012300269.1.9421 XP_012916784.1.14098 XP_015998971.1.101085 XP_016802693.1.37143 XP_017394047.1.71028 XP_017727537.1.44346 XP_019288238.1.44245 XP_019521581.1.44202 XP_020140269.1.48125 XP_021534823.1.83697 ENSP00000369629 ENSMMUP00000003198 gi|68800128|ref|NP_001020374.1| ENSP00000369629 ENSMICP00000012617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]