SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006997 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006997
Domain Number 1 Region: 250-316
Classification Level Classification E-value
Superfamily FnI-like domain 4.54e-16
Family VWC domain 0.0044
Further Details:      
 
Domain Number 2 Region: 32-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000924
Family VWC domain 0.017
Further Details:      
 
Domain Number 3 Region: 109-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000105
Family VWC domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006997   Gene: ENSPTRG00000004069   Transcript: ENSPTRT00000007581
Sequence length 451
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:72461220:72498447:-1 gene:ENSPTRG00000004069 transcript:ENSPTRT00000007581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLR
CTCSESAHVSCYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQH
GEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASE
QSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTV
KIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPC
RHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEA
SDLVEIYLWKLVKGECWPTPSGVYLCLVSALRNLPLDSDQESQEARLPERGTALPTARWP
PRRSLERLPSPDPAEGHGQSRQSDQDIITKT
Download sequence
Identical sequences ENSPTRP00000006997 ENSPTRP00000006997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]