SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007000 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007000
Domain Number 1 Region: 119-273,370-410
Classification Level Classification E-value
Superfamily L domain-like 4.76e-23
Family Internalin LRR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007000   Gene: ENSPTRG00000004071   Transcript: ENSPTRT00000007584
Sequence length 792
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:72604829:72712917:-1 gene:ENSPTRG00000004071 transcript:ENSPTRT00000007584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKGLVGAQAERRE
SLKATSFEFKGKKGSRRENQVDLPGRILDQAFLLKHHCVRKPSDLCTINAKENDFKHFHS
VIYINASENLLPLEAFHMFPALKELDLAFNGIKTIYVKYGDFKLLEFLDLSFNSLTVEAI
CDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALETLMLDDNRL
SNPSCFASLAGLRRLKKLSLDENRIIRIPYLQQVQLYDESVDWNGGRGSPHKEPQFMLQS
KPRMLEDSDEQLDYTVLPMKKDVDRTEVVFSSYPGFSTSETTKICSLPPIFEILPVKSLK
ARNQTLAPPFPELRYLSLAYNKIAKEDAVLPVALFPSLCEFVFHNNPLVAHTRGVPPLLK
SFLQERLGIHLIRRKIVKPKHHVLMSRKESWKVKSKIPKVPKQPLVLHHPRVTTTKSPSK
DMLEPEAELAEDLPTTKSTSVESEMPTESLEGHSPSRRTFVPLPPICSDSTVHSEETLSH
LSDTTVRLSPERPSDEDSKSTESIFLTQVSELPSSVIHKDDLELKEKDQKKPPTAPREVK
GTRRKLPTAFLPSKYHGYEELLTAKPDPAFTEPKGIQKNAQALQQMLKHPLLCHSSKPKL
DTLQKPYVHKEKRAQRIPIPPPKKTRAQLLDDIFIRLRDPRNITEAPLGAVLHQWTERRL
VNHKQYLEAKRLLKEFQARYRQLVSGSLRTVFGTTPLPTACPALSESQPKFGHFLEFMDE
FCQEPTASDSQG
Download sequence
Identical sequences ENSPTRP00000007000 ENSPTRP00000007000 9598.ENSPTRP00000007000 XP_003814739.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]