SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007033 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007033
Domain Number 1 Region: 62-223,321-423,457-578
Classification Level Classification E-value
Superfamily L domain-like 3.8e-51
Family Ngr ectodomain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 217-277
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.000000000183
Family Outer arm dynein light chain 1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007033   Gene: ENSPTRG00000004094   Transcript: ENSPTRT00000007621
Sequence length 662
Comment pep:known chromosome:CHIMP2.1.4:11:74429158:74440287:-1 gene:ENSPTRG00000004094 transcript:ENSPTRT00000007621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQGLGLLQVPSVLPPDTETLDLSGNQ
LRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGL
GPLPHVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDL
HSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQ
AEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSAL
PLSAPSGNASARPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRSG
SLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLE
VATGALGGLESSLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEV
LDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLIC
RFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLATCCCVRRQKFNQQY
KA
Download sequence
Identical sequences H2Q4F9
ENSPTRP00000007033 ENSPTRP00000007033 9598.ENSPTRP00000007033 XP_003808202.1.60992 XP_003952033.1.37143 XP_008958503.1.60992 XP_014202425.1.60992 XP_016777145.1.37143 XP_016777147.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]