SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007058 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007058
Domain Number 1 Region: 261-470
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-73
Family Protein kinases, catalytic subunit 0.00000000279
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007058
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0353
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007058   Gene: ENSPTRG00000004101   Transcript: ENSPTRT00000007647
Sequence length 471
Comment pep:known chromosome:CHIMP2.1.4:11:75119320:75176156:-1 gene:ENSPTRG00000004101 transcript:ENSPTRT00000007647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR
Download sequence
Identical sequences ENSPTRP00000007058 ENSPTRP00000007058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]