SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007086 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007086
Domain Number 1 Region: 1229-1568
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-23
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1466-1707
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000216
Family SGL-like 0.07
Further Details:      
 
Domain Number 3 Region: 924-995
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000549
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 633-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000617
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007086
Domain Number - Region: 763-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000228
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 666-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 733-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 599-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00464
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007086   Gene: ENSPTRG00000004118   Transcript: ENSPTRT00000007680
Sequence length 2769
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:76470519:76881924:-1 gene:ENSPTRG00000004118 transcript:ENSPTRT00000007680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKERKPYRSLTRRRDAERRYTSSSADSEEGKAPQKSYSSSETLKAYDQDARLAYGSRV
KDIVPQEAEEFCRTGANFTLRELGLEEVTPPHGTLYRTDIGLPHCGYSMGAGSDADMEAD
TVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETDHPGGLQNHARLRTPP
PPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQDNWL
LNSNIPLETRNLGKQPFLGTLQDNLIEMDILGTSRHDGAYSDGHFLFKPGGTSPLFCTTS
PGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSKYCNWKCAALSAIVISATLVILLAYF
VAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTDVSLYPSGGTGLETPDRKGKGTTEGK
PSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHLKFNVSLGKAALVGIYG
RKGLPPSHTQFDFVELLDGRRLLIQEARSLEGTPRQSRGTVPPSSHETGFIQYLDSGIWH
LAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISGTCHCFLGFLGPDCGRASCPVL
CSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNHGTCITGTCICNPGYKGESCEEV
DCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHGTFLQDTGLCSCDPSWT
GHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPG
WNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWHCVCQLGWRGAGCDTSMETACGD
SKDNDGDGLLDCMDPDCCLQPMCHINPLCLGSPNPLDIIQETQVPVSQQNLHSFYDRIKF
LVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQDGSF
DLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMETIIMRHEENEIPSCDLSNFARPN
PVVSPSPLTSFASSCAEKGPIVPEIQALQEEISISGCKMRLSYLSSRTPGYKSVLRISLT
HPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVSVGY
EYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQP
PVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSLYVGDFNYIRRIFPSGNV
TNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLSDSNSRRVFKIKSTVVVKDLVKNSEV
VAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRIDQNGIIST
LLGSNDLTSARPLSCDSVMDISQVHLEWPTDLAINPMDNSLYVLDNNVVLQISENHQVRI
VAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIAETDEKKINRIRQVTTS
GEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAVCADGELYVADLGNIRI
RFIRKNKPFLNTQNMYELSSPIDQELYLFDTTGKHLYTQSLPTGDYLYNFTYTGDGDITL
ITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHELAMMTYHGNSG
LLATKSSENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDVTITT
NLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAGTVNPTVGKRNV
TLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRTEKIYDDHRKFT
LRILYDQAGRPSLWSPSSRLNGVNVTYSPGGYIAGIQRGIMSERMEYDQAGRITSRIFAD
GKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVARQTLETIRSVGYYRNIYQ
PPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGM
LKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSFRVTSMQAVINE
TPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRMKEVQYEIFR
SLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQTVSINDKPLWRYSYDLN
GNLHLLSPGNSARLTPLRYDIRDRITRLGDVQYKMDEDGFLRQRGGDIFEYNSAGLLIKA
YNRAGSWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTKVTHLYNHSSSEITSLYYD
LQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYTAYGEIYMDTNPNFQIII
GYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKHLSSSNVMPFNLYMFKNNNPISN
SQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAMEPSYELIHTQMKTQEWDNSKSIL
GVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPKTKKFASSSSVFGKGVKFALKDGRVT
TDIISVANEDGRRVAAILNHAHYLENLHFTIDGVDTHYFVKPGPSEGDLAILGLSGGRRT
LENGVNVTVSQINTVLNGRTRRYTDIQLQYGALCLNTRYGTTLDEEKARVLELARQRAVR
QAWAREQQRLREGEEGLRAWTEGEKQQVLSTGRVQGYDGFFVISVEQYPELSDSANNIHF
MRQSEMGRR
Download sequence
Identical sequences 9598.ENSPTRP00000007086 ENSPTRP00000007086 ENSPTRP00000007086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]