SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007225 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007225
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007225   Gene: ENSPTRG00000000593   Transcript: ENSPTRT00000007833
Sequence length 119
Comment pep:novel chromosome:CHIMP2.1.4:1:40834569:40846072:1 gene:ENSPTRG00000000593 transcript:ENSPTRT00000007833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISFQESVTFQDVAVDFTAEEWQLLDCAERTLYWDVMLENYRNLISVGCPITKTKVILKV
EQGQEPWMVEEVNPHESSPESRSVARLECSGTISARVQVILLPQPPEELELQAPATMPG
Download sequence
Identical sequences H2Q4L4
ENSPTRP00000007225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]