SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007397 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007397
Domain Number 1 Region: 198-295
Classification Level Classification E-value
Superfamily Immunoglobulin 8.54e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 102-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000427
Family C1 set domains (antibody constant domain-like) 0.032
Further Details:      
 
Domain Number 3 Region: 9-104
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000394
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007397   Gene: ENSPTRG00000004310   Transcript: ENSPTRT00000008016
Sequence length 400
Comment pep:known chromosome:CHIMP2.1.4:11:113055345:113120946:-1 gene:ENSPTRG00000004310 transcript:ENSPTRT00000008016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLN
FSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEE
IEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQ
VEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWV
RVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPT
TTTTTTTTTTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARH
KGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
Download sequence
Identical sequences A0A2I3RGT2 A0A2K5M8E5 A0A2K5X0V8 A0A2K5YTY9 A0A2K6DZ03 A0A2K6M0G0
ENSPTRP00000007397 ENSPTRP00000007397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]